IRAK4 (NM_016123) Human Mass Spec Standard
CAT#: PH303041
IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207)
View other "IRAK4" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203041 |
| Predicted MW | 51.5 kDa |
| Protein Sequence |
>RC203041 protein sequence
Red=Cloning site Green=Tags(s) MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057207 |
| RefSeq Size | 4303 |
| RefSeq ORF | 1380 |
| Synonyms | IMD67; IPD1; IRAK-4; NY-REN-64; REN64 |
| Locus ID | 51135 |
| Cytogenetics | 12q12 |
| Summary | This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402503 | IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426473 | IRAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402503 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2 |
CNY 3080.00 |
|
| LY426473 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1 |
CNY 3080.00 |
|
| TP303041 | Recombinant protein of human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP761970 | Purified recombinant protein of Human interleukin-1 receptor-associated kinase 4 (IRAK4), transcript variant 1,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |


