C16orf13 (METTL26) (NM_001040161) Human Mass Spec Standard
CAT＃: PH303002
C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251)
View other "C16orf13" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203002 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC203002 protein sequence
Red=Cloning site Green=Tags(s) MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEW GLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035251 |
| RefSeq Size | 570 |
| RefSeq ORF | 321 |
| Synonyms | C16orf13; JFP2 |
| Locus ID | 84326 |
| Cytogenetics | 16p13.3 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410160 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421703 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410160 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 |
CNY 3080.00 |
|
| LY421703 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 3 |
CNY 3080.00 |
|
| PH318337 | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_115742) |
CNY 19520.00 |
|
| TP303002 | Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318337 | Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C16orf13产品
