OPA3 (NM_025136) Human Mass Spec Standard
CAT#: PH302959
OPA3 MS Standard C13 and N15-labeled recombinant protein (NP_079412)
View other "OPA3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | OPA3 MS Standard C13 and N15-labeled recombinant protein (NP_079412) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202959 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC202959 protein sequence
Red=Cloning site Green=Tags(s) MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079412 |
RefSeq Size | 7889 |
RefSeq ORF | 537 |
Synonyms | MGA3 |
Locus ID | 80207 |
Cytogenetics | 19q13.32 |
Summary | The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410876 | OPA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410876 | Transient overexpression lysate of optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
TP302959 | Recombinant protein of human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), transcript variant 2, 20 µg |
CNY 2900.00 |