ROR alpha (RORA) (NM_134261) Human Mass Spec Standard
CAT#: PH302926
RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023)
View other "ROR alpha" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202926 |
| Predicted MW | 58.8 kDa |
| Protein Sequence |
>RC202926 representing NM_134261
Red=Cloning site Green=Tags(s) MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_599023 |
| RefSeq Size | 1847 |
| RefSeq ORF | 1569 |
| Synonyms | IDDECA; NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA |
| Locus ID | 6095 |
| Cytogenetics | 15q22.2 |
| Summary | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401041 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403350 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408623 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401041 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3 |
CNY 4840.00 |
|
| LY403350 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1 |
CNY 3080.00 |
|
| LY408623 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4 |
CNY 4840.00 |
|
| TP302926 | Recombinant protein of human RAR-related orphan receptor A (RORA), transcript variant 1, 20 µg |
CNY 2900.00 |
其它ROR alpha产品


