AP2S1 (NM_004069) Human Mass Spec Standard
CAT#: PH302919
AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060)
View other "AP2S1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AP2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004060) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202919 |
| Predicted MW | 17 kDa |
| Protein Sequence |
>RC202919 protein sequence
Red=Cloning site Green=Tags(s) MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS LE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004060 |
| RefSeq Size | 965 |
| RefSeq ORF | 426 |
| Synonyms | AP17; CLAPS2; FBH3; FBHOk; HHC3 |
| Locus ID | 1175 |
| Cytogenetics | 19q13.32 |
| Summary | One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Pathways | Endocytosis, Huntington's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418235 | AP2S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418235 | Transient overexpression lysate of adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17 |
CNY 3080.00 |
|
| TP302919 | Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17, 20 µg |
CNY 2900.00 |
