MOSPD3 (NM_023948) Human Mass Spec Standard
CAT＃: PH302908
MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438)
View other "MOSPD3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202908 |
| Predicted MW | 25.5 kDa |
| Protein Sequence |
>RC202908 protein sequence
Red=Cloning site Green=Tags(s) MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVL CTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAY PLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQV LHVSLGQKLVAAYVLGLLTMVFLRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_076438 |
| RefSeq Size | 1213 |
| RefSeq ORF | 705 |
| Synonyms | CDS3; NET30 |
| Locus ID | 64598 |
| Cytogenetics | 7q22.1 |
| Summary | This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411401 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421670 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421671 | MOSPD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411401 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 1 |
CNY 3080.00 |
|
| LY421670 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 2 |
CNY 3080.00 |
|
| LY421671 | Transient overexpression lysate of motile sperm domain containing 3 (MOSPD3), transcript variant 3 |
CNY 3080.00 |
|
| TP302908 | Recombinant protein of human motile sperm domain containing 3 (MOSPD3), transcript variant 1, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
