TSSC4 (NM_005706) Human Mass Spec Standard
CAT#: PH302870
TSSC4 MS Standard C13 and N15-labeled recombinant protein (NP_005697)
View other "TSSC4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TSSC4 MS Standard C13 and N15-labeled recombinant protein (NP_005697) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202870 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC202870 protein sequence
Red=Cloning site Green=Tags(s) MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPS GLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKRPLAPSGRSPVEGLGRA HRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGE GRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSPHGGLQE VEALSGSVHSGSVPGLPPVETVGFHGSRKRSRDHFRNKSSSPEDPGAEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005697 |
RefSeq Size | 1749 |
RefSeq ORF | 987 |
Locus ID | 10078 |
Cytogenetics | 11p15.5 |
Summary | This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (PHEMX), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417124 | TSSC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417124 | Transient overexpression lysate of tumor suppressing subtransferable candidate 4 (TSSC4) |
CNY 3080.00 |
|
TP302870 | Recombinant protein of human tumor suppressing subtransferable candidate 4 (TSSC4), 20 µg |
CNY 2900.00 |