NUDT11 (NM_018159) Human Mass Spec Standard
CAT#: PH302840
NUDT11 MS Standard C13 and N15-labeled recombinant protein (NP_060629)
View other "NUDT11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | NUDT11 MS Standard C13 and N15-labeled recombinant protein (NP_060629) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202840 |
| Predicted MW | 18.6 kDa |
| Protein Sequence |
>RC202840 protein sequence
Red=Cloning site Green=Tags(s) MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL EKLKLGGSPTNGNSMAPSSPDSDP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060629 |
| RefSeq Size | 2413 |
| RefSeq ORF | 492 |
| Synonyms | APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta |
| Locus ID | 55190 |
| Cytogenetics | Xp11.22 |
| Summary | NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al., 2002 [PubMed 12105228]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413258 | NUDT11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413258 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 11 (NUDT11) |
CNY 3080.00 |
|
| TP302840 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 11 (NUDT11), 20 µg |
CNY 2900.00 |
