ING4 (NM_016162) Human Mass Spec Standard
CAT＃: PH302827
ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246)
View other "ING4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_057246) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202827 |
| Predicted MW | 28.5 kDa |
| Protein Sequence |
>RC202827 protein sequence
Red=Cloning site Green=Tags(s) MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057246 |
| RefSeq Size | 1458 |
| RefSeq ORF | 747 |
| Synonyms | my036; p29ING4 |
| Locus ID | 51147 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402512 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426813 | ING4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402512 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 1 |
CNY 3080.00 |
|
| LY426813 | Transient overexpression lysate of inhibitor of growth family, member 4 (ING4), transcript variant 6 |
CNY 3080.00 |
|
| PH325191 | ING4 MS Standard C13 and N15-labeled recombinant protein (NP_001121058) |
CNY 14250.00 |
|
| TP302827 | Recombinant protein of human inhibitor of growth family, member 4 (ING4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325191 | Purified recombinant protein of Homo sapiens inhibitor of growth family, member 4 (ING4), transcript variant 6, 20 µg |
CNY 2900.00 |
