PSMC6 (NM_002806) Human Mass Spec Standard
CAT#: PH302809
PSMC6 MS Standard C13 and N15-labeled recombinant protein (NP_002797)
View other "PSMC6" proteins (6)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | PSMC6 MS Standard C13 and N15-labeled recombinant protein (NP_002797) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC202809 | 
| Predicted MW | 44.2 kDa | 
| Protein Sequence | 
                 >RC202809 protein sequence 
Red=Cloning site Green=Tags(s) MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002797 | 
| RefSeq Size | 1599 | 
| RefSeq ORF | 1167 | 
| Synonyms | p42; RPT5; SUG2 | 
| Locus ID | 5706 | 
| Cytogenetics | 14q22.1 | 
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008] | 
| Protein Pathways | Proteasome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400994 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC432217 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400994 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) | 
                                                     CNY 3080.00  | 
                                            |
| LY432217 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) | 
                                                     CNY 3080.00  | 
                                            |
| TP302809 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP761520 | Purified recombinant protein of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 
                                                     CNY 2040.00  | 
                                            
