Serum Amyloid P (APCS) (NM_001639) Human Mass Spec Standard
CAT#: PH302802
APCS MS Standard C13 and N15-labeled recombinant protein (NP_001630)
View other "Serum Amyloid P" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | APCS MS Standard C13 and N15-labeled recombinant protein (NP_001630) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202802 |
| Predicted MW | 25.4 kDa |
| Protein Sequence |
>RC202802 protein sequence
Red=Cloning site Green=Tags(s) MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFS YNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQ GYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYE IRGYVIIKPLVWV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001630 |
| RefSeq Size | 960 |
| RefSeq ORF | 669 |
| Synonyms | HEL-S-92n; PTX2; SAP |
| Locus ID | 325 |
| Cytogenetics | 1q23.2 |
| Summary | The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400617 | APCS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400617 | Transient overexpression lysate of amyloid P component, serum (APCS) |
CNY 3080.00 |
|
| TP302802 | Recombinant protein of human amyloid P component, serum (APCS), 20 µg |
CNY 2900.00 |
其它Serum Amyloid P产品
