ARHI (DIRAS3) (NM_004675) Human Mass Spec Standard
CAT#: PH302787
DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666)
View other "ARHI" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202787 |
| Predicted MW | 25.9 kDa |
| Protein Sequence |
>RC202787 protein sequence
Red=Cloning site Green=Tags(s) MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE KKSQMPNTTEKLLDKCIIM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004666 |
| RefSeq Size | 1642 |
| RefSeq ORF | 687 |
| Synonyms | ARHI; NOEY2 |
| Locus ID | 9077 |
| Cytogenetics | 1p31.3 |
| Summary | This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401484 | DIRAS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401484 | Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 3 (DIRAS3) |
CNY 3080.00 |
|
| TP302787 | Recombinant protein of human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), 20 µg |
CNY 2900.00 |
