Surb7 (MED21) (NM_004264) Human Mass Spec Standard
CAT#: PH302763
MED21 MS Standard C13 and N15-labeled recombinant protein (NP_004255)
View other "Surb7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MED21 MS Standard C13 and N15-labeled recombinant protein (NP_004255) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202763 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC202763 protein sequence
Red=Cloning site Green=Tags(s) MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS LPDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004255 |
RefSeq Size | 2705 |
RefSeq ORF | 432 |
Synonyms | hSrb7; SRB7; SURB7 |
Locus ID | 9412 |
Cytogenetics | 12p11.23 |
Summary | This gene encodes a member of the mediator complex subunit 21 family. The encoded protein interacts with the human RNA polymerase II holoenzyme and is involved in transcriptional regulation of RNA polymerase II transcribed genes. A pseudogene of this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418106 | MED21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418106 | Transient overexpression lysate of mediator complex subunit 21 (MED21) |
CNY 3080.00 |
|
TP302763 | Recombinant protein of human mediator complex subunit 21 (MED21), 20 µg |
CNY 2900.00 |