PAIP1 (NM_182789) Human Mass Spec Standard
CAT#: PH302735
PAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_877590)
View other "PAIP1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_877590) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202735 |
| Predicted MW | 45.6 kDa |
| Protein Sequence |
>RC202735 protein sequence
Red=Cloning site Green=Tags(s) MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYE DGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGA RLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQ VTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCS RDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLER EDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_877590 |
| RefSeq Size | 2559 |
| RefSeq ORF | 1200 |
| Locus ID | 10605 |
| Cytogenetics | 5p12 |
| Summary | The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405243 | PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405357 | PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405243 | Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 3 |
CNY 3080.00 |
|
| LY405357 | Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2 |
CNY 3080.00 |
|
| TP302735 | Recombinant protein of human poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2, 20 µg |
CNY 2900.00 |
