VAMP4 (NM_003762) Human Mass Spec Standard
CAT#: PH302734
VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753)
View other "VAMP4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202734 |
| Predicted MW | 16.2 kDa |
| Protein Sequence |
>RC202734 protein sequence
Red=Cloning site Green=Tags(s) MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003753 |
| RefSeq Size | 5155 |
| RefSeq ORF | 420 |
| Synonyms | VAMP-4; VAMP24 |
| Locus ID | 8674 |
| Cytogenetics | 1q24.3 |
| Summary | Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418448 | VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433976 | VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418448 | Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4) |
CNY 3080.00 |
|
| LY433976 | Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4), transcript variant 2 |
CNY 3080.00 |
|
| TP302734 | Recombinant protein of human vesicle-associated membrane protein 4 (VAMP4), 20 µg |
CNY 2900.00 |
