PAR4 (PAWR) (NM_002583) Human Mass Spec Standard
CAT#: PH302733
PAWR MS Standard C13 and N15-labeled recombinant protein (NP_002574)
View other "PAR4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PAWR MS Standard C13 and N15-labeled recombinant protein (NP_002574) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202733 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC202733 protein sequence
Red=Cloning site Green=Tags(s) MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002574 |
RefSeq Size | 1967 |
RefSeq ORF | 1020 |
Synonyms | Par-4; PAR4 |
Locus ID | 5074 |
Cytogenetics | 12q21.2 |
Summary | This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419234 | PAWR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419234 | Transient overexpression lysate of PRKC, apoptosis, WT1, regulator (PAWR) |
CNY 3080.00 |
|
TP302733 | Recombinant protein of human PRKC, apoptosis, WT1, regulator (PAWR), 20 µg |
CNY 2900.00 |