HUS1 (NM_004507) Human Mass Spec Standard
CAT#: PH302727
HUS1 MS Standard C13 and N15-labeled recombinant protein (NP_004498)
View other "HUS1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HUS1 MS Standard C13 and N15-labeled recombinant protein (NP_004498) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202727 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC202727 protein sequence
Red=Cloning site Green=Tags(s) MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQME GVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPR KLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCVTTHFKDLGN PPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004498 |
| RefSeq Size | 3033 |
| RefSeq ORF | 840 |
| Synonyms | hHUS1 |
| Locus ID | 3364 |
| Cytogenetics | 7p12.3 |
| Summary | The protein encoded by this gene is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex that is involved in the cell cycle arrest in response to DNA damage. This protein forms a heterotrimeric complex with checkpoint proteins RAD9 and RAD1. In response to DNA damage, the trimeric complex interacts with another protein complex consisting of checkpoint protein RAD17 and four small subunits of the replication factor C (RFC), which loads the combined complex onto the chromatin. The DNA damage induced chromatin binding has been shown to depend on the activation of the checkpoint kinase ATM, and is thought to be an early checkpoint signaling event. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401435 | HUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401435 | Transient overexpression lysate of HUS1 checkpoint homolog (S. pombe) (HUS1) |
CNY 3080.00 |
|
| TP302727 | Recombinant protein of human HUS1 checkpoint homolog (S. pombe) (HUS1), 20 µg |
CNY 2900.00 |
