IL18 (NM_001562) Human Mass Spec Standard
CAT#: PH302716
IL18 MS Standard C13 and N15-labeled recombinant protein (NP_001553)
View other "IL18" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IL18 MS Standard C13 and N15-labeled recombinant protein (NP_001553) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202716 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC202716 protein sequence
Red=Cloning site Green=Tags(s) MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001553 |
RefSeq Size | 1163 |
RefSeq ORF | 579 |
Synonyms | IGIF; IL-1g; IL-18; IL1F4 |
Locus ID | 3606 |
Cytogenetics | 11q23.1 |
Summary | The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to its active form by caspase-1, and is capable of stimulating interferon gamma production, and of regulating both T helper (Th) 1 and Th2 responses. This cytokine has been implicated in the injury of different organs, and in potentially fatal conditions characterized by a cytokine storm. In humans, IL-18 gene is located on chromosome 11. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400599 | IL18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400599 | Transient overexpression lysate of interleukin 18 (interferon-gamma-inducing factor) (IL18) |
CNY 3080.00 |
|
TP302716 | Recombinant protein of human interleukin 18 (interferon-gamma-inducing factor) (IL18), 20 µg |
CNY 2900.00 |
|
TP720840 | Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18) |
CNY 1800.00 |
|
TP721161 | Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18) |
CNY 3140.00 |