NDUFS4 (NM_002495) Human Mass Spec Standard
CAT#: PH302713
NDUFS4 MS Standard C13 and N15-labeled recombinant protein (NP_002486)
View other "NDUFS4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NDUFS4 MS Standard C13 and N15-labeled recombinant protein (NP_002486) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202713 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC202713 protein sequence
Red=Cloning site Green=Tags(s) MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEE HIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEK NGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002486 |
| RefSeq Size | 676 |
| RefSeq ORF | 525 |
| Synonyms | AQDQ; CI-18; CI-18 kDa; CI-AQDQ; MC1DN1 |
| Locus ID | 4724 |
| Cytogenetics | 5q11.2 |
| Summary | This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419295 | NDUFS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419295 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (NDUFS4), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP302713 | Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (NDUFS4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
