CXCL5 (NM_002994) Human Mass Spec Standard
CAT＃: PH302707
CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985)
View other "CXCL5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202707 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC202707 protein sequence
Red=Cloning site Green=Tags(s) MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002985 |
| RefSeq Size | 2505 |
| RefSeq ORF | 342 |
| Synonyms | ENA-78; SCYB5 |
| Locus ID | 6374 |
| Cytogenetics | 4q13.3 |
| Summary | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401049 | CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401049 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) |
CNY 3080.00 |
|
| TP302707 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), 20 µg |
CNY 2900.00 |
|
| TP700192 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug |
CNY 6650.00 |
|
| TP700193 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug |
CNY 6650.00 |
|
| TP700194 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug |
CNY 6650.00 |
|
| TP720876 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) |
CNY 1800.00 |
