ARL 1 (ARL1) (NM_001177) Human Mass Spec Standard
CAT#: PH302698
ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168)
View other "ARL 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202698 |
| Predicted MW | 20.4 kDa |
| Protein Sequence |
>RC202698 protein sequence
Red=Cloning site Green=Tags(s) MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001168 |
| RefSeq Size | 3253 |
| RefSeq ORF | 543 |
| Synonyms | ARFL1 |
| Locus ID | 400 |
| Cytogenetics | 12q23.2 |
| Summary | The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420086 | ARL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420086 | Transient overexpression lysate of ADP-ribosylation factor-like 1 (ARL1) |
CNY 3080.00 |
|
| TP302698 | Recombinant protein of human ADP-ribosylation factor-like 1 (ARL1), 20 µg |
CNY 2900.00 |
