C1orf41 (HSPB11) (NM_016126) Human Mass Spec Standard
CAT#: PH302693
HSPB11 MS Standard C13 and N15-labeled recombinant protein (NP_057210)
View other "C1orf41" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HSPB11 MS Standard C13 and N15-labeled recombinant protein (NP_057210) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202693 |
| Predicted MW | 16.3 kDa |
| Protein Sequence |
>RC202693 protein sequence
Red=Cloning site Green=Tags(s) MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS NLSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057210 |
| RefSeq Size | 601 |
| RefSeq ORF | 432 |
| Synonyms | C1orf41; FAP232; HSPCO34; IFT25; PP25 |
| Locus ID | 51668 |
| Cytogenetics | 1p32.3 |
| Summary | Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414172 | HSPB11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414172 | Transient overexpression lysate of heat shock protein family B (small), member 11 (HSPB11) |
CNY 3080.00 |
|
| TP302693 | Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11), 20 µg |
CNY 2900.00 |
|
| TP720224 | Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11) |
CNY 1800.00 |
其它C1orf41产品
