EIF1B (NM_005875) Human Mass Spec Standard
CAT#: PH302691
EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866)
View other "EIF1B" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202691 |
| Predicted MW | 12.8 kDa |
| Protein Sequence |
>RC202691 protein sequence
Red=Cloning site Green=Tags(s) MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005866 |
| RefSeq Size | 1014 |
| RefSeq ORF | 339 |
| Synonyms | GC20 |
| Locus ID | 10289 |
| Cytogenetics | 3p22.1 |
| Summary | Probably involved in translation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416997 | EIF1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416997 | Transient overexpression lysate of eukaryotic translation initiation factor 1B (EIF1B) |
CNY 3080.00 |
|
| TP302691 | Recombinant protein of human eukaryotic translation initiation factor 1B (EIF1B), 20 µg |
CNY 2900.00 |
|
| TP720195 | Recombinant protein of human eukaryotic translation initiation factor 1B (EIF1B) |
CNY 1800.00 |
