ALKBH7 (NM_032306) Human Mass Spec Standard
CAT#: PH302583
ALKBH7 MS Standard C13 and N15-labeled recombinant protein (NP_115682)
View other "ALKBH7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ALKBH7 MS Standard C13 and N15-labeled recombinant protein (NP_115682) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202583 |
Predicted MW | 24.5 kDa |
Protein Sequence |
>RC202583 protein sequence
Red=Cloning site Green=Tags(s) MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG PGESGQPPPAC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115682 |
RefSeq Size | 1331 |
RefSeq ORF | 663 |
Synonyms | ABH7; SPATA11; UNQ6002 |
Locus ID | 84266 |
Cytogenetics | 19p13.3 |
Summary | May function as protein hydroxylase; can catalyze auto-hydroxylation at Leu-110 (in vitro), but this activity may be due to the absence of the true substrate (PubMed:25122757). Required to induce programmed necrosis in response to DNA damage caused by cytotoxic alkylating agents. Acts by triggering the collapse of mitochondrial membrane potential and loss of mitochondrial function that leads to energy depletion and cell death (PubMed:23666923). ALKBH7-mediated necrosis is probably required to prevent the accumulation of cells with DNA damage (PubMed:23666923). Does not display DNA demethylase activity (PubMed:23666923). Involved in fatty acid metabolism (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403154 | ALKBH7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403154 | Transient overexpression lysate of alkB, alkylation repair homolog 7 (E. coli) (ALKBH7) |
CNY 3080.00 |
|
TP302583 | Recombinant protein of human alkB, alkylation repair homolog 7 (E. coli) (ALKBH7), 20 µg |
CNY 2900.00 |