Aldolase (ALDOA) (NM_000034) Human Mass Spec Standard
CAT#: PH302576
ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_000025)
View other "Aldolase" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_000025) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202576 |
| Predicted MW | 39.4 kDa |
| Protein Sequence |
>RC202576 protein sequence
Red=Cloning site Green=Tags(s) MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000025 |
| RefSeq Size | 2408 |
| RefSeq ORF | 1092 |
| Synonyms | ALDA; GSD12; HEL-S-87p |
| Locus ID | 226 |
| Cytogenetics | 16p11.2 |
| Summary | This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400006 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405206 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405207 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426825 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400006 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
CNY 3080.00 |
|
| LY405206 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 |
CNY 3080.00 |
|
| LY405207 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 |
CNY 3080.00 |
|
| LY426825 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 |
CNY 3080.00 |
|
| PH303900 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908930) |
CNY 19520.00 |
|
| PH303908 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908932) |
CNY 19520.00 |
|
| PH325547 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_001121089) |
CNY 19520.00 |
|
| TP302576 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP303900 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP303908 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP325547 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP720179 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
CNY 1800.00 |
其它Aldolase产品

