IGFBP2 (NM_000597) Human Mass Spec Standard
CAT#: PH302573
IGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_000588)
View other "IGFBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | IGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_000588) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202573 |
Predicted MW | 35 kDa |
Protein Sequence |
>RC202573 representing NM_000597
Red=Cloning site Green=Tags(s) MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAV AGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDA EYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGK HHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLN GQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000588 |
RefSeq Size | 1439 |
RefSeq ORF | 984 |
Synonyms | IBP2; IGF-BP53 |
Locus ID | 3485 |
Cytogenetics | 2q35 |
Summary | The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424614 | IGFBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424614 | Transient overexpression lysate of insulin-like growth factor binding protein 2, 36kDa (IGFBP2) |
CNY 3080.00 |
|
TP302573 | Recombinant protein of human insulin-like growth factor binding protein 2, 36kDa (IGFBP2), 20 µg |
CNY 2900.00 |