HEY2 (NM_012259) Human Mass Spec Standard
CAT#: PH302544
HEY2 MS Standard C13 and N15-labeled recombinant protein (NP_036391)
View other "HEY2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HEY2 MS Standard C13 and N15-labeled recombinant protein (NP_036391) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202544 |
Predicted MW | 35.8 kDa |
Protein Sequence |
>RC202544 protein sequence
Red=Cloning site Green=Tags(s) MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSE LRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSV EGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPNGLHASESTPC RLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPL SFAGAFPMLPPNAAAAVAAATAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036391 |
RefSeq Size | 2672 |
RefSeq ORF | 1011 |
Synonyms | bHLHb32; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2 |
Locus ID | 23493 |
Cytogenetics | 6q22.31 |
Summary | This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402181 | HEY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402181 | Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 2 (HEY2) |
CNY 3,080.00 |
|
TP302544 | Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 2 (HEY2), 20 µg |
CNY 2,900.00 |