Follistatin (FST) (NM_013409) Human Mass Spec Standard
CAT#: PH302523
FST MS Standard C13 and N15-labeled recombinant protein (NP_037541)
View other "Follistatin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FST MS Standard C13 and N15-labeled recombinant protein (NP_037541) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202523 |
Predicted MW | 38 kDa |
Protein Sequence |
>RC202523 protein sequence
Red=Cloning site Green=Tags(s) MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037541 |
RefSeq Size | 1834 |
RefSeq ORF | 1032 |
Synonyms | FS |
Locus ID | 10468 |
Cytogenetics | 5q11.2 |
Summary | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415607 | FST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416705 | FST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415607 | Transient overexpression lysate of follistatin (FST), transcript variant FST344 |
CNY 3080.00 |
|
LY416705 | Transient overexpression lysate of follistatin (FST), transcript variant FST317 |
CNY 3080.00 |
|
PH315777 | FST MS Standard C13 and N15-labeled recombinant protein (NP_006341) |
CNY 19520.00 |
|
TP302523 | Recombinant protein of human follistatin (FST), transcript variant FST344, 20 µg |
CNY 2900.00 |
|
TP315777 | Recombinant protein of human follistatin (FST), transcript variant FST317, 20 µg |
CNY 2900.00 |
其它Follistatin产品