TACD2 (TACSTD2) (NM_002353) Human Mass Spec Standard
CAT＃: PH302519
TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344)
View other "TACD2" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202519 |
| Predicted MW | 35.7 kDa |
| Protein Sequence |
>RC202519 protein sequence
Red=Cloning site Green=Tags(s) MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002344 |
| RefSeq Size | 2080 |
| RefSeq ORF | 969 |
| Synonyms | EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2 |
| Locus ID | 4070 |
| Cytogenetics | 1p32.1 |
| Summary | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419381 | TACSTD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419381 | Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) |
CNY 3080.00 |
|
| TP302519 | Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 20 µg |
CNY 2900.00 |
|
| TP721339 | Human Trop2 Protein (C-His) |
CNY 2450.00 |
|
| TP721340 | Human Trop2 Protein (C-His-Avi) |
CNY 2450.00 |
|
| TP721341 | Biotinylated Human Trop2 Protein (C-His-Avi) |
CNY 3480.00 |
|
| TP721342 | PE Conjugated Human Trop2 Protein (C-His) |
CNY 3480.00 |
|
| TP721343 | APC Conjugated Human Trop2 Protein (C-His) |
CNY 3480.00 |
|
| TP721344 | Human Trop2 Protein (C-Fc) |
CNY 2450.00 |
|
| TP721345 | Human Trop2 Protein (C-Fc-Avi) |
CNY 2450.00 |
|
| TP721346 | Biotinylated Human Trop2 Protein (C-Fc-Avi) |
CNY 3480.00 |
|
| TP721347 | PE Conjugated Human Trop2 Protein (C-Fc) |
CNY 3480.00 |
|
| TP721348 | APC Conjugated Human Trop2 Protein (C-Fc) |
CNY 3480.00 |
|
| TP724028 | Human Trop2 Protein, mFc-His Tag |
CNY 5249.00 |
Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 100 µg
