Guanylate kinase (GUK1) (NM_000858) Human Mass Spec Standard
CAT#: PH302510
GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849)
View other "Guanylate kinase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202510 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC202510 protein sequence
Red=Cloning site Green=Tags(s) MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDF IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTE TEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000849 |
| RefSeq Size | 1155 |
| RefSeq ORF | 591 |
| Synonyms | GMK |
| Locus ID | 2987 |
| Cytogenetics | 1q42.13 |
| Summary | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400303 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431782 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400303 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 2 |
CNY 3080.00 |
|
| LY431782 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 3 |
CNY 3080.00 |
|
| TP302510 | Recombinant protein of human guanylate kinase 1 (GUK1), 20 µg |
CNY 2900.00 |
其它Guanylate kinase产品
