Uteroglobin (SCGB1A1) (NM_003357) Human Mass Spec Standard
CAT#: PH302497
SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348)
View other "Uteroglobin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202497 |
| Predicted MW | 10 kDa |
| Protein Sequence |
>RC202497 protein sequence
Red=Cloning site Green=Tags(s) MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003348 |
| RefSeq Size | 452 |
| RefSeq ORF | 273 |
| Synonyms | CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1 |
| Locus ID | 7356 |
| Cytogenetics | 11q12.3 |
| Summary | This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418739 | SCGB1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418739 | Transient overexpression lysate of secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) |
CNY 3080.00 |
|
| TP302497 | Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), 20 µg |
CNY 2900.00 |
其它Uteroglobin产品
