ING2 (NM_001564) Human Mass Spec Standard
CAT#: PH302478
ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555)
View other "ING2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202478 |
| Predicted MW | 32.8 kDa |
| Protein Sequence |
>RC202478 protein sequence
Red=Cloning site Green=Tags(s) MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001555 |
| RefSeq Size | 2465 |
| RefSeq ORF | 840 |
| Synonyms | ING1L; p33ING2 |
| Locus ID | 3622 |
| Cytogenetics | 4q35.1 |
| Summary | This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419856 | ING2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419856 | Transient overexpression lysate of inhibitor of growth family, member 2 (ING2) |
CNY 3080.00 |
|
| TP302478 | Recombinant protein of human inhibitor of growth family, member 2 (ING2), 20 µg |
CNY 2900.00 |
