MMP1 (NM_002421) Human Mass Spec Standard
CAT#: PH302460
MMP1 MS Standard C13 and N15-labeled recombinant protein (NP_002412)
View other "MMP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MMP1 MS Standard C13 and N15-labeled recombinant protein (NP_002412) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202460 |
Predicted MW | 54 kDa |
Protein Sequence |
>RC202460 protein sequence
Red=Cloning site Green=Tags(s) MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002412 |
RefSeq Size | 2081 |
RefSeq ORF | 1407 |
Synonyms | CLG; CLGN |
Locus ID | 4312 |
Cytogenetics | 11q22.2 |
Summary | This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Bladder cancer, Pathways in cancer, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419340 | MMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419340 | Transient overexpression lysate of matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 3080.00 |
|
TP302460 | Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720322 | Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 1800.00 |
|
TP723882 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 5240.00 |
|
TP760405 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP762607 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |