beta Synuclein (SNCB) (NM_003085) Human Mass Spec Standard
CAT#: PH302449
SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076)
View other "beta Synuclein" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202449 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC202449 protein sequence
Red=Cloning site Green=Tags(s) MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003076 |
RefSeq Size | 1310 |
RefSeq ORF | 402 |
Locus ID | 6620 |
Cytogenetics | 5q35.2 |
Summary | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401075 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424365 | SNCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401075 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 2 |
CNY 3080.00 |
|
LY424365 | Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 |
CNY 3080.00 |
|
PH315165 | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_001001502) |
CNY 19520.00 |
|
TP302449 | Recombinant protein of human synuclein, beta (SNCB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP315165 | Recombinant protein of human synuclein, beta (SNCB), transcript variant 1, 20 µg |
CNY 2900.00 |
其它beta Synuclein产品