VEGFB (NM_003377) Human Mass Spec Standard
CAT#: PH302426
VEGFB MS Standard C13 and N15-labeled recombinant protein (NP_003368)
View other "VEGFB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | VEGFB MS Standard C13 and N15-labeled recombinant protein (NP_003368) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202426 |
| Predicted MW | 21.6 kDa |
| Protein Sequence |
>RC202426 protein sequence
Red=Cloning site Green=Tags(s) MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003368 |
| RefSeq Size | 1822 |
| RefSeq ORF | 621 |
| Synonyms | VEGFL; VRF |
| Locus ID | 7423 |
| Cytogenetics | 11q13.1 |
| Summary | This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418732 | VEGFB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418732 | Transient overexpression lysate of vascular endothelial growth factor B (VEGFB) |
CNY 3080.00 |
|
| TP302426 | Recombinant protein of human vascular endothelial growth factor B (VEGFB), 20 µg |
CNY 2900.00 |
