STARD5 (NM_181900) Human Mass Spec Standard
CAT#: PH302407
STARD5 MS Standard C13 and N15-labeled recombinant protein (NP_871629)
View other "STARD5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | STARD5 MS Standard C13 and N15-labeled recombinant protein (NP_871629) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202407 |
Predicted MW | 23.8 kDa |
Protein Sequence |
>RC202407 protein sequence
Red=Cloning site Green=Tags(s) MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ FHE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_871629 |
RefSeq Size | 1344 |
RefSeq ORF | 639 |
Locus ID | 80765 |
Cytogenetics | 15q25.1 |
Summary | Proteins containing a steroidogenic acute regulatory-related lipid transfer (START) domain are often involved in the trafficking of lipids and cholesterol between diverse intracellular membranes. This gene is a member of the StarD subfamily that encodes START-related lipid transfer proteins. The protein encoded by this gene is a cholesterol transporter and is also able to bind and transport other sterol-derived molecules related to the cholesterol/bile acid biosynthetic pathways such as 25-hydroxycholesterol. Its expression is upregulated during endoplasmic reticulum (ER) stress. The protein is thought to act as a cytosolic sterol transporter that moves cholesterol between intracellular membranes such as from the cytoplasm to the ER and from the ER to the Golgi apparatus. Alternative splicing of this gene produces multiple transcript variants. [provided by RefSeq, Jan 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405583 | STARD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405583 | Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 5 (STARD5) |
CNY 3080.00 |
|
TP302407 | Recombinant protein of human StAR-related lipid transfer (START) domain containing 5 (STARD5), 20 µg |
CNY 2900.00 |