CRYBA2 (NM_057094) Human Mass Spec Standard
CAT#: PH302403
CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476435)
View other "CRYBA2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476435) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202403 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC202403 protein sequence
Red=Cloning site Green=Tags(s) MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFIL EKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDV GSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_476435 |
RefSeq Size | 709 |
RefSeq ORF | 591 |
Synonyms | CTRCT42 |
Locus ID | 1412 |
Cytogenetics | 2q35 |
Summary | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409256 | CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409257 | CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417446 | CRYBA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409256 | Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 2 |
CNY 3080.00 |
|
LY409257 | Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 3 |
CNY 3080.00 |
|
LY417446 | Transient overexpression lysate of crystallin, beta A2 (CRYBA2), transcript variant 1 |
CNY 3080.00 |
|
PH316085 | CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_005200) |
CNY 19520.00 |
|
PH323668 | CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_476434) |
CNY 19520.00 |
|
TP302403 | Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP316085 | Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP323668 | Recombinant protein of human crystallin, beta A2 (CRYBA2), transcript variant 2, 20 µg |
CNY 2900.00 |