Cytochrome b5 (CYB5A) (NM_148923) Human Mass Spec Standard
CAT#: PH302378
CYB5A MS Standard C13 and N15-labeled recombinant protein (NP_683725)
View other "Cytochrome b5" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CYB5A MS Standard C13 and N15-labeled recombinant protein (NP_683725) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202378 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC202378 protein sequence
Red=Cloning site Green=Tags(s) MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_683725 |
RefSeq Size | 850 |
RefSeq ORF | 402 |
Synonyms | CYB5; MCB5; METAG |
Locus ID | 1528 |
Cytogenetics | 18q22.3 |
Summary | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Dissociation Constants of Cytochrome P450 2C9/Cytochrome P450 Reductase Complexes in a Lipid Bilayer Membrane Depend on NADPH: A Single-Protein Tracking Study.
,null,
Journal of the American Chemical Society
,PubMed ID 29148818
[CYB5A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403451 | CYB5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403451 | Transient overexpression lysate of cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1 |
CNY 3080.00 |
|
TP302378 | Recombinant protein of human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720192 | Recombinant protein of human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 3. |
CNY 1800.00 |
其它Cytochrome b5产品