ITM2B (NM_021999) Human Mass Spec Standard
CAT#: PH302377
ITM2B MS Standard C13 and N15-labeled recombinant protein (NP_068839)
View other "ITM2B" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ITM2B MS Standard C13 and N15-labeled recombinant protein (NP_068839) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202377 |
| Predicted MW | 30.4 kDa |
| Protein Sequence |
>RC202377 protein sequence
Red=Cloning site Green=Tags(s) MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVIL GGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIE NIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068839 |
| RefSeq Size | 1896 |
| RefSeq ORF | 798 |
| Synonyms | ABRI; BRI; BRI2; BRICD2B; E3-16; E25B; FBD; imBRI2; RDGCA |
| Locus ID | 9445 |
| Cytogenetics | 13q14.2 |
| Summary | Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411840 | ITM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411840 | Transient overexpression lysate of integral membrane protein 2B (ITM2B) |
CNY 3080.00 |
|
| TP302377 | Recombinant protein of human integral membrane protein 2B (ITM2B), 20 µg |
CNY 2900.00 |
|
| TP721036 | Purified recombinant protein of Human integral membrane protein 2B (ITM2B) |
CNY 1800.00 |
