SKA1 (NM_145060) Human Mass Spec Standard
CAT#: PH302370
SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_659497)
View other "SKA1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_659497) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202370 |
| Predicted MW | 29.5 kDa |
| Protein Sequence |
>RC202370 protein sequence
Red=Cloning site Green=Tags(s) MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659497 |
| RefSeq Size | 2893 |
| RefSeq ORF | 765 |
| Synonyms | C18orf24 |
| Locus ID | 220134 |
| Cytogenetics | 18q21.1 |
| Summary | Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020). In the complex, it mediates the interaction with microtubules (PubMed:19289083, PubMed:23085020).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408057 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422066 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425642 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408057 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 1 (SKA1), transcript variant 2 |
CNY 3080.00 |
|
| LY422066 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 1 (SKA1), transcript variant 1 |
CNY 3080.00 |
|
| PH321913 | SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_001034624) |
CNY 19520.00 |
|
| TP302370 | Recombinant protein of human chromosome 18 open reading frame 24 (C18orf24), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321913 | Recombinant protein of human chromosome 18 open reading frame 24 (C18orf24), transcript variant 1, 20 µg |
CNY 2900.00 |
