SLBP (NM_006527) Human Mass Spec Standard
CAT#: PH302361
SLBP MS Standard C13 and N15-labeled recombinant protein (NP_006518)
View other "SLBP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | SLBP MS Standard C13 and N15-labeled recombinant protein (NP_006518) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202361 |
Predicted MW | 31.3 kDa |
Protein Sequence |
>RC202361 protein sequence
Red=Cloning site Green=Tags(s) MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRS RCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQK QINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEI HPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006518 |
RefSeq Size | 1743 |
RefSeq ORF | 810 |
Synonyms | HBP |
Locus ID | 7884 |
Cytogenetics | 4p16.3 |
Summary | This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401962 | SLBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401962 | Transient overexpression lysate of stem-loop binding protein (SLBP) |
CNY 3080.00 |
|
TP302361 | Purified recombinant protein of Homo sapiens stem-loop binding protein (SLBP), 20 µg |
CNY 2900.00 |