NEIL1 (NM_024608) Human Mass Spec Standard
CAT#: PH302329
NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884)
View other "NEIL1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202329 |
| Predicted MW | 43.7 kDa |
| Protein Sequence |
>RC202329 representing NM_024608
Red=Cloning site Green=Tags(s) MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_078884 |
| RefSeq Size | 1896 |
| RefSeq ORF | 1170 |
| Synonyms | FPG1; hFPG1; NEI1 |
| Locus ID | 79661 |
| Cytogenetics | 15q24.2 |
| Summary | This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411199 | NEIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411199 | Transient overexpression lysate of nei endonuclease VIII-like 1 (E. coli) (NEIL1) |
CNY 3080.00 |
|
| TP302329 | Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1), 20 µg |
CNY 2900.00 |
|
| TP762007 | Purified recombinant protein of Human nei endonuclease VIII-like 1 (E. coli) (NEIL1),Leu186-Ser390, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |
