UBA5 (NM_024818) Human Mass Spec Standard
CAT#: PH302327
UBA5 MS Standard C13 and N15-labeled recombinant protein (NP_079094)
View other "UBA5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBA5 MS Standard C13 and N15-labeled recombinant protein (NP_079094) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202327 |
| Predicted MW | 44.7 kDa |
| Protein Sequence |
>RC202327 representing NM_024818
Red=Cloning site Green=Tags(s) MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079094 |
| RefSeq Size | 2720 |
| RefSeq ORF | 1212 |
| Synonyms | DEE44; EIEE44; SCAR24; THIFP1; UBE1DC1 |
| Locus ID | 79876 |
| Cytogenetics | 3q22.1 |
| Summary | This gene encodes a member of the E1-like ubiquitin-activating enzyme family. This protein activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been identified on chromosome 1. [provided by RefSeq, Feb 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405021 | UBA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411039 | UBA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405021 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 2 |
CNY 3080.00 |
|
| LY411039 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 |
CNY 3080.00 |
|
| TP302327 | Recombinant protein of human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721148 | Purified recombinant protein of Human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 |
CNY 1800.00 |
