C14orf126 (DTD2) (NM_080664) Human Mass Spec Standard
CAT#: PH302312
C14orf126 MS Standard C13 and N15-labeled recombinant protein (NP_542395)
View other "C14orf126" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C14orf126 MS Standard C13 and N15-labeled recombinant protein (NP_542395) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202312 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC202312 protein sequence
Red=Cloning site Green=Tags(s) MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLS ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEAR VVVEHGTYGNRQVLKLDTNGPFTHLIEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542395 |
RefSeq Size | 2696 |
RefSeq ORF | 504 |
Synonyms | ATD; C14orf126 |
Locus ID | 112487 |
Cytogenetics | 14q12 |
Summary | Deacylates mischarged D-aminoacyl-tRNAs (By similarity). Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity). Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr) (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS (PubMed:29410408). Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed:29410408). Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409050 | DTD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409050 | Transient overexpression lysate of chromosome 14 open reading frame 126 (C14orf126) |
CNY 3080.00 |
|
TP302312 | Recombinant protein of human chromosome 14 open reading frame 126 (C14orf126), 20 µg |
CNY 2900.00 |
其它C14orf126产品