RAB7B (NM_177403) Human Mass Spec Standard
CAT#: PH302283
RAB7B MS Standard C13 and N15-labeled recombinant protein (NP_796377)
View other "RAB7B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB7B MS Standard C13 and N15-labeled recombinant protein (NP_796377) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202283 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC202283 protein sequence
Red=Cloning site Green=Tags(s) MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_796377 |
| RefSeq Size | 3032 |
| RefSeq ORF | 597 |
| Synonyms | RAB7 |
| Locus ID | 338382 |
| Cytogenetics | 1q32.1 |
| Summary | Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406153 | RAB7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431783 | RAB7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406153 | Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 |
CNY 3080.00 |
|
| LY431783 | Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 2 |
CNY 3080.00 |
|
| TP302283 | Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), 20 µg |
CNY 2900.00 |
|
| TP328755 | Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), transcript variant 2, 20 µg |
CNY 2900.00 |
