Hemoglobin subunit epsilon (HBE1) (NM_005330) Human Mass Spec Standard
CAT#: PH302247
HBE1 MS Standard C13 and N15-labeled recombinant protein (NP_005321)
View other "Hemoglobin subunit epsilon" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HBE1 MS Standard C13 and N15-labeled recombinant protein (NP_005321) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202247 |
| Predicted MW | 16.2 kDa |
| Protein Sequence |
>RC202247 protein sequence
Red=Cloning site Green=Tags(s) MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLT SFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAI ALAHKYH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005321 |
| RefSeq Size | 816 |
| RefSeq ORF | 441 |
| Synonyms | HBE |
| Locus ID | 3046 |
| Cytogenetics | 11p15.4 |
| Summary | The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3' [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417377 | HBE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417377 | Transient overexpression lysate of hemoglobin, epsilon 1 (HBE1) |
CNY 3080.00 |
|
| TP302247 | Recombinant protein of human hemoglobin, epsilon 1 (HBE1), 20 µg |
CNY 2900.00 |
其它Hemoglobin subunit epsilon产品
