MYCBP (NM_012333) Human Mass Spec Standard
CAT#: PH302238
MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465)
View other "MYCBP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202238 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC202238 protein sequence
Red=Cloning site Green=Tags(s) MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036465 |
| RefSeq Size | 2583 |
| RefSeq ORF | 309 |
| Synonyms | AMY-1 |
| Locus ID | 26292 |
| Cytogenetics | 1p34.3 |
| Summary | The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415829 | MYCBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415829 | Transient overexpression lysate of c-myc binding protein (MYCBP) |
CNY 3080.00 |
|
| TP302238 | Recombinant protein of human c-myc binding protein (MYCBP), 20 µg |
CNY 2900.00 |
