CD164 (NM_006016) Human Mass Spec Standard
CAT#: PH302234
CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007)
View other "CD164" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202234 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC202234 protein sequence
Red=Cloning site Green=Tags(s) MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006007 |
| RefSeq Size | 3128 |
| RefSeq ORF | 591 |
| Synonyms | DFNA66; endolyn; MGC-24; MGC-24v; MUC-24 |
| Locus ID | 8763 |
| Cytogenetics | 6q21 |
| Summary | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016] |
| Protein Families | Secreted Protein, Transmembrane |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416885 | CD164 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416885 | Transient overexpression lysate of CD164 molecule, sialomucin (CD164), transcript variant 1 |
CNY 3080.00 |
|
| TP302234 | Recombinant protein of human CD164 molecule, sialomucin (CD164), transcript variant 1, 20 µg |
CNY 2900.00 |
