PDK3 (NM_005391) Human Mass Spec Standard
CAT#: PH302207
PDK3 MS Standard C13 and N15-labeled recombinant protein (NP_005382)
View other "PDK3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PDK3 MS Standard C13 and N15-labeled recombinant protein (NP_005382) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202207 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC202207 protein sequence
Red=Cloning site Green=Tags(s) MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFD PFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ YYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKED LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005382 |
RefSeq Size | 1803 |
RefSeq ORF | 1218 |
Synonyms | CMTX6; GS1-358P8.4 |
Locus ID | 5165 |
Cytogenetics | Xp22.11 |
Summary | The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401655 | PDK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428060 | PDK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401655 | Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2 |
CNY 3080.00 |
|
LY428060 | Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 1 |
CNY 3080.00 |
|
TP302207 | Recombinant protein of human pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2, 20 µg |
CNY 2900.00 |