DNAJA2 (NM_005880) Human Mass Spec Standard
CAT#: PH302204
DNAJA2 MS Standard C13 and N15-labeled recombinant protein (NP_005871)
View other "DNAJA2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DNAJA2 MS Standard C13 and N15-labeled recombinant protein (NP_005871) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202204 |
| Predicted MW | 45.7 kDa |
| Protein Sequence |
>RC202204 protein sequence
Red=Cloning site Green=Tags(s) MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYG EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKV IKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALC GFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005871 |
| RefSeq Size | 3066 |
| RefSeq ORF | 1236 |
| Synonyms | CPR3; DJ3; DJA2; DNAJ; DNJ3; HIRIP4; PRO3015; RDJ2 |
| Locus ID | 10294 |
| Cytogenetics | 16q11.2 |
| Summary | The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401779 | DNAJA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401779 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 2 (DNAJA2) |
CNY 3080.00 |
|
| TP302204 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily A, member 2 (DNAJA2), 20 µg |
CNY 2900.00 |
